PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000999.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 278aa    MW: 31650.4 Da    PI: 5.654
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000999.1_g00009.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.58.4e-26111159452
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               +  e++skyF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ sl
  Itr_sc000999.1_g00009.1 111 MLCRETISKYFYMPITKAARELNVGLTLLKKRCRELGIRRWPHRKLMSL 159
                              567899****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.24596179IPR003035RWP-RK domain
PfamPF020424.2E-21112159IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVPGENNLQL SFPVQSWSDN NLAWDYDHDD YDYDFPVQTT YHYTSFDYHS FPLMDNYMFL  60
INDPLYSHPT QSIIQGGGSV VYGDEGVEEQ QKMGDDGGNN KKKGRNDCSK MLCRETISKY  120
FYMPITKAAR ELNVGLTLLK KRCRELGIRR WPHRKLMSLQ TLISNVQVLG KNEEEEKLRE  180
AVQLLEKQKR EIEESPDMEM EDTTKKLRQA CFKANYKKRK LTVSVSGAGM SSSSPSSAPA  240
ISAGATAATV DYEEDHQMDS LLSYYFSSSS SSSTAIHY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525466.13e-67PREDICTED: protein RKD1-like
TrEMBLA0A0R0JQB74e-67A0A0R0JQB7_SOYBN; Uncharacterized protein
STRINGGLYMA05G01030.25e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-50RWP-RK domain-containing protein